TNFRSF1A monoclonal antibody (M45), clone 7F12
* The price is valid only in USA. Please select country.
- More Files
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNFRSF1A is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TNFRSF1A.
Immunogen
TNFRSF1A (NP_001056.1, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNFRSF1A is 0.03 ng/ml as a capture antibody.ELISA
- Gene Info — TNFRSF1A
Entrez GeneID
7132GeneBank Accession#
NM_001065.1Protein Accession#
NP_001056.1Gene Name
TNFRSF1A
Gene Alias
CD120a, FPF, MGC19588, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
Gene Description
tumor necrosis factor receptor superfamily, member 1A
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq
Other Designations
tumor necrosis factor binding protein 1|tumor necrosis factor receptor 1|tumor necrosis factor receptor type 1|tumor necrosis factor-alpha receptor
- Interactomes
- Pathways
- Diseases