TYMS monoclonal antibody (M01), clone 3A1
* The price is valid only in USA. Please select country.
- More Files
Western Blot (Cell lysate)
TYMS monoclonal antibody (M01), clone 3A1 Western Blot analysis of TYMS expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of TYMS expression in transfected 293T cell line by TYMS monoclonal antibody (M01), clone 3A1.
Lane 1: TYMS transfected lysate(35.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TYMS is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TYMS on HeLa cell. [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (36.52 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TYMS.
Immunogen
TYMS (AAH13919, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
TYMS monoclonal antibody (M01), clone 3A1 Western Blot analysis of TYMS expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TYMS expression in transfected 293T cell line by TYMS monoclonal antibody (M01), clone 3A1.
Lane 1: TYMS transfected lysate(35.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TYMS on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TYMS is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TYMS on HeLa cell. [antibody concentration 20 ug/ml] - Gene Info — TYMS
Entrez GeneID
7298GeneBank Accession#
BC013919Protein Accession#
AAH13919Gene Name
TYMS
Gene Alias
HsT422, MGC88736, TMS, TS, TSase
Gene Description
thymidylate synthetase
Omim ID
188350Gene Ontology
HyperlinkGene Summary
Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. [provided by RefSeq
Other Designations
Thymidylate synthase
- Interactomes
- Pathways
- Diseases