CD34 Peptide - C-terminal region

Referencia AAP60993

embalaje : 100ug

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

CD34 Peptide - C-terminal region (AAP60993)

Data Sheet
 
Sku AAP60993
Old sku AAPP47131
Name CD34 Peptide - C-terminal region (AAP60993)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CD34
Gene id 947
Description of target CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells.
Swissprot id Q3C1E7
Protein accession num NP_001764
Nucleotide accession num NM_001773
Protein size 328 amino acids
Molecular weight 35kDa
Species reactivity Human
Application IHC, WB
Peptide sequence DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR
Partner proteins CHST4,CRKL,PRKCD,ATF5,CREM,CRKL
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CD34 Antibody (ARP60993_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com