EIF2B5 antibody - N-terminal region
Referencia ARP61329_P050
embalaje : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-EIF2B5 (ARP61329_P050) antibody |
---|
Publications | Cellular eIF2B subunit localization: implications for the integrated stress response and its control by small molecule drugs. Mol Biol Cell. 30, 942-958 (2019). 307261661$s> Stoichiometry of the eIF2B complex is maintained by mutual stabilization of subunits. Biochem. J. 473, 571-80 (2016). 266147651$s> |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Human, Rat, Cow, Dog, Horse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 92%; Horse: 85%; Human: 100%; Rat: 85% |
Peptide Sequence | Synthetic peptide located within the following region: GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-EIF2B5 (ARP61329_P050) antibody is Catalog # AAP61329 (Previous Catalog # AAPP47461) |
Subunit | epsilon |
Gene Symbol | EIF2B5 |
---|---|
Gene Full Name | Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa |
Alias Symbols | CLE, CACH, LVWM, EIF-2B, EIF2Bepsilon |
NCBI Gene Id | 8893 |
Protein Name | Translation initiation factor eIF-2B subunit epsilon |
Description of Target | This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. |
Uniprot ID | Q13144 |
Protein Accession # | NP_003898 |
Nucleotide Accession # | NM_003907 |
Protein Size (# AA) | 721 |
Molecular Weight | 80 kDa |
Protein Interactions | UBC; EGFR; EIF2B2; EIF2B3; EIF2B4; APP; CHMP2A; GSK3A; GSK3B; EIF2S2; CSNK1A1; CSNK2A2; CSNK2A1; EIF2B1; |