EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF) (MaxLight 650)
Referencia 245789-ML650-100ul
embalaje : 100ul
Marca : US Biological
245789-ML650 EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF) (MaxLight 650)
Clone Type
PolyclonalHost
mouseIsotype
IgG2a,kGrade
PurifiedApplications
FLISA WBAccession #
NP_001018051Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeMaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. ||This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. [provided by RefSeq||Applications: |Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. ||Note: Applications are based on unconjugated antibody.