EVX1 Antibody - N-terminal region : FITC
Referencia P100830_T100-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-EVX1 (P100830_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EVX1 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-EVX1 (P100830_T100) antibody is Catalog # AAP31183 (Previous Catalog # AAPP01926) |
Reference | Scherer, S.W., et al., (2003) Science 300 (5620), 767-772 |
---|---|
Gene Symbol | EVX1 |
Gene Full Name | Even-skipped homeobox 1 |
Alias Symbols | EVX-1 |
NCBI Gene Id | 2128 |
Protein Name | Homeobox even-skipped homolog protein 1 |
Description of Target | EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis. |
Uniprot ID | P49640 |
Protein Accession # | NP_001980 |
Nucleotide Accession # | NM_001989 |
Protein Size (# AA) | 407 |
Molecular Weight | 42kDa |
Protein Interactions | RAD21; |