LEPROTL1 antibody
Referencia orb326676-100ul
embalaje : 100ul
Marca : Biorbyt
LEPROTL1 antibody
Catalog Number: orb326676
Catalog Number | orb326676 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LEPROTL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14kDa |
Target | LEPROTL1 |
UniProt ID | O95214 |
Protein Sequence | Synthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI |
NCBI | NP_056159 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HSPC112 antibody, anti Vps55 antibody, anti m |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human 721_B tissue using LEPROTL1 antibody
Western blot analysis of human Hela tissue using LEPROTL1 antibody
Western blot analysis of human Fetal Liver tissue using LEPROTL1 antibody
Western blot analysis of human HepG2 tissue using LEPROTL1 antibody
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Fetal Liver lysates, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Human Hela, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.