MAP1LC3A Antibody - N-terminal region
Referencia ARP51335_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for ARP51335_P050 |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MAP1LC3A |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPV |
Concentration | 0.5 mg/ml |
Blocking Peptide | Catalog # AAP51335 (Previous Catalog # AAPS23512) |
Reference | Taylor,M.P. (2007) J. Virol. 81 (22), 12543-12553 |
Publications | Icariside II, a phosphodiesterase 5 inhibitor, attenuates cerebral ischaemia/reperfusion injury by inhibiting glycogen synthase kinase-3β-mediated activation of autophagy. Br J Pharmacol. 177, 1434-1452 (2020). 31658364 |
Gene Symbol | MAP1LC3A |
---|---|
Gene Full Name | Microtubule-associated protein 1 light chain 3 alpha |
Alias Symbols | LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3 |
NCBI Gene Id | 84557 |
Protein Name | Microtubule-associated proteins 1A/1B light chain 3A |
Description of Target | MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B.MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | Q9H492-2 |
Protein Accession # | NP_852610 |
Nucleotide Accession # | NM_181509 |
Protein Size (# AA) | 125 |
Molecular Weight | 14kDa |
Protein Interactions | FAM134C; FUNDC1; KXD1; tat; TNIP1; SQSTM1; UBC; OPTN; TOLLIP; EPAS1; ATG4B; LGALS3; ATG13; ATG101; SRPK1; HNRNPM; PGAP1; FYCO1; UBQLN4; PADI3; UBQLN1; PELP1; SERBP1; DDX17; TUBB4B; TUBA1B; MATR3; VPRBP; ASAP2; CLTCL1; HNRNPU; HNRNPH1; EPRS; EPHA7; EGFR; D |
-
What is the species homology for "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".
-
How long will it take to receive "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)"?
This target may also be called "LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3" in publications.
-
What is the shipping cost for "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "14kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MAP1LC3A Antibody - N-terminal region (ARP51335_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MAP1LC3A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MAP1LC3A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MAP1LC3A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MAP1LC3A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MAP1LC3A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MAP1LC3A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.