600195 | Mouse IL-15 Clinisciences

Recombinant Active Protein

Cat. No.

600195

Unit

0.01 mg

Description

Interleukin-15 (IL-15) is a pleiotropic pro-inflammatory cytokine that is expressed in several inflammatory disorders, including rheumatoid arthritis, psoriasis and pulmonary inflammatory diseases. IL-15 promotes activation of T cells, neutrophils and macrophages, and is critical to dendritic cell function in several model systems. Recent emerging data suggest that IL-15 may serve as a useful therapeutic target across a range of disease states. Advances in the past year highlight the beneficial effect of IL-15 neutralization in models of psoriasis and diabetes. Further evidence for IL-15 expression and effector function has emerged across a range of rheumatic disorders, including juvenile inflammatory arthritis, rheumatoid arthritis and Kawasaki disease. Interleukin-15 (IL-15) is a gamma-common cytokine, which plays an important role in the development, survival and proliferation of NK, NK T and CD8+ T cells. Recombinant Mouse IL-15 produced in E. coli is a single non-glycosylated polypeptide chain containing 115 amino acids with a MW of 13,321 Da.

Spec Container

Datasheet

Format

Each vial contains 10 ug protein lyophilized in 10 mM sodium phosphate pH8.0. Reconstitute with 0.1 ml sterile deionized water for a final concentration of 0.1 mg/ml.

Alternate Names

Interleukin-15; IL-15

Accession No.

P48346

13321 Da

Sequence

MNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTA MNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKN VAESGCKECE ELEEKTFTEFLQSFIRIVQMFINTS

Source

E. coli. Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.

Purity

Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.

Application Notes

Recombinant mouse IL-15 is fully biologically active when compared to standards. The ED50, as determined by dose-dependent induction of CTLL-2 cell proliferation, is 2.5 ng/ml.

Storage

Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.

Images

For research use only, not for diagnostic or therapeutic procedures.

Mouse IL-15

Referencia 600195

Contact local distributor :

Marca : Abbiotec

Contact local distributor :

Spec Container