MYL3 Antibody - N-terminal region : FITC

Referencia ARP41381_P050-FITC

embalaje : 100ul

Marca : Aviva Systems Biology

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

MYL3 Antibody - N-terminal region (ARP41381_P050)

Datasheets/ManualsPrintable datasheet for anti-MYL3 (ARP41381_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MYL3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG
Concentration0.5 mg/ml
Blocking PeptideFor anti-MYL3 (ARP41381_P050) antibody is Catalog # AAP41381
Sample Type Confirmation

MYL3 is supported by BioGPS gene expression data to be expressed in COLO205

ReferenceBos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134
Gene SymbolMYL3
Gene Full NameMyosin, light chain 3, alkali; ventricular, skeletal, slow
Alias SymbolsCMH8, VLC1, VLCl, MLC1V, MLC1SB, MLC-lV/sb
NCBI Gene Id4634
Protein NameMyosin light chain 3
Description of TargetMYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypert
Uniprot IDQ5R887
Protein Accession #NP_000249
Nucleotide Accession #NM_000258
Protein Size (# AA)195
Molecular Weight22kDa
Protein InteractionsUBC; ATG101; FTH1; SP1; YWHAQ; CASP3;