SPIB Antibody - C-terminal region : HRP
Referencia ARP31422_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-SPIB (ARP31422_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SPIB |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SPIB (ARP31422_P050) antibody is Catalog # AAP31422 (Previous Catalog # AAPP03080) |
Sample Type Confirmation | SPIB is supported by BioGPS gene expression data to be expressed in Daudi |
Reference | Geng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271 |
---|---|
Gene Symbol | SPIB |
Gene Full Name | Spi-B transcription factor (Spi-1/PU.1 related) |
Alias Symbols | SPI-B |
NCBI Gene Id | 6689 |
Protein Name | Transcription factor Spi-B |
Description of Target | SPI1 (MIM 165170) and SPIB are members of a subfamily of ETS (see ETS1; MIM 164720) transcription factors. ETS proteins share a conserved ETS domain that mediates specific DNA binding. SPIB and SPI1 bind to a purine-rich sequence, the PU box (5-prime-GAGGAA-3-prime). |
Uniprot ID | Q01892 |
Protein Accession # | NP_003112 |
Nucleotide Accession # | NM_003121 |
Protein Size (# AA) | 177 |
Molecular Weight | 19kDa |
Protein Interactions | TMEM37; SSB; GATA1; IRF4; MAPK3; MAPK8; CREBBP; TBP; CEBPB; RB1; SPI1; JUN; CSNK2A2; CSNK2A1; SPIB; E2F4; E2F3; E2F2; E2F1; |