Tcf3 Antibody - C-terminal region
Referencia ARP30966_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Tcf3 Antibody - C-terminal region (ARP30966_P050)
| Datasheets/Manuals | Printable datasheet for anti-Tcf3 (ARP30966_P050) antibody |
|---|
| Tested Species Reactivity | Rat |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tcf3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | Available upon request |
| Gene Symbol | Tcf3 |
|---|---|
| Gene Full Name | transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) |
| Alias Symbols | Pan2, Tcfe2a |
| NCBI Gene Id | 171046 |
| Protein Name | Transcription factor E2-alpha |
| Description of Target | Tcf3 is a transcriptional regulator; It binds enhancer motifs of pancreatic exocrine genes. |
| Uniprot ID | P21677 |
| Protein Accession # | NP_598208 |
| Nucleotide Accession # | NM_133524 |
| Protein Size (# AA) | 649 |
| Molecular Weight | 71kDa |
| Protein Interactions | Dact2; Psmd9; Twist1; Id3; |
