Clinisciences > YY1 Antibody - middle region : Biotin
YY1 Antibody - middle region : Biotin
Referencia P100898_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
Solicitar más información
Por favor, inicie sesión para usar esta función.
Datasheets/Manuals | Printable datasheet for anti-YY1 (P100898_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human YY1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92% |
Peptide Sequence | Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-YY1 (P100898_P050) antibody is Catalog # AAP31246 (Previous Catalog # AAPP01991) |
Reference | Gronroos,E., et al., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12165-12170 |
---|---|
Gene Symbol | YY1 |
Gene Full Name | YY1 transcription factor |
Alias Symbols | DELTA, NF-E1, UCRBP, GADEVS, INO80S, YIN-YANG-1 |
NCBI Gene Id | 7528 |
Protein Name | Transcriptional repressor protein YY1 |
Description of Target | YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. |
Uniprot ID | P25490 |
Protein Accession # | NP_003394 |
Nucleotide Accession # | NM_003403 |
Protein Size (# AA) | 414 |
Molecular Weight | 45kDa |
Protein Interactions | HDAC1; SMURF2; UBC; SHFM1; RNF2; BMI1; SUZ12; RYBP; GABPB1; GABPA; PCGF2; RING1; EP300; LAMC2; SPRY1; SLC39A7; NR1H2; TESK1; RAF1; NFKB1; GRN; CRKL; ARRB1; SP1; WDHD1; ZNF24; NHP2L1; NCL; ZNF830; APP; ZNF638; EED; SMAD3; SMAD2; EZH2; SUMO1; SUMO3; INO80E; |
Protein interactions
Name | # of Products |
---|---|
ACTL6A | 58 |
ACTR5 | 21 |
ACTR8 | 19 |
ATF2 | 93 |
ATF7 | 28 |
BAP1 | 69 |
BCL6 | 157 |
CREB1 | 152 |
EP300 | 986 |
HCFC1 | 82 |
HDAC1 | 928 |
HDAC2 | 549 |
HDAC3 | 422 |
HSPA4 | 423 |
HSPA5 | 264 |
INO80 | 20 |
INO80B | 24 |
INO80C | 21 |
INO80D | 18 |
INO80E | 22 |
JUNB | 26 |
JUND | 52 |
MCRS1 | 79 |
MECP2 | 41 |
NFE2L2 | 86 |
NFRKB | 15 |
PRKDC | 226 |
RB1 | 474 |
RELB | 45 |
RUVBL1 | 229 |
RUVBL2 | 239 |
SP1 | 551 |
T | 51 |
TCF3 | 151 |
TERF1 | 223 |
TERF2 | 313 |
TFCP2 | 27 |
TFPT | 41 |
TP53 | 1010 |
UBC | 7030 |
UCHL5 | 365 |
UHRF2 | 207 |
XRCC5 | 185 |
XRCC6 | 272 |
YY1 | 211 |
Biological process
Name | # of Products |
---|---|
Anterior/posterior pattern specification | 119 |
Camera-type eye morphogenesis | 18 |
Cell differentiation | 490 |
Cellular response to UV | 29 |
Chromosome organization | 20 |
DNA recombination | 76 |
DNA repair | 251 |
Double-strand break repair via homologous recombination | 39 |
Negative regulation of transcription from RNA polymerase II promoter | 574 |
Regulation of transcription from RNA polymerase II promoter | 308 |
Response to DNA damage stimulus | 144 |
Response to UV-C | 7 |
RNA localization | 3 |
Spermatogenesis | 230 |
Cellular components
Name | # of Products |
---|---|
Ino80 complex | 11 |
Intracellular | 1678 |
Nuclear matrix | 64 |
Nucleus | 4914 |
PcG protein complex | 23 |
Plasma membrane | 2678 |
Transcription factor complex | 286 |
Protein function
Name | # of Products |
---|---|
DNA binding | 3958 |
Four-way junction DNA binding | 16 |
Metal ion binding | 5514 |
Protein binding | 12191 |
RNA binding | 1153 |
Sequence-specific DNA binding transcription factor activity | 2776 |
Transcription coactivator activity | 587 |
Transcription corepressor activity | 425 |
Transcription regulatory region DNA binding | 657 |
Zinc ion binding | 3721 |
- YY1 Antibody - middle region (P100899_P050)Catalog #: P100899_P050Species Tested: Human, MouseApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- YY1 Antibody - N-terminal region (ARP38301_P050)Catalog #: ARP38301_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- YY1 Antibody - middle region (OAAB15923)Catalog #: OAAB15923Application: WBFormat: Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.Size: 200ul
- YY1 Antibody (OAAB17748)Catalog #: OAAB17748Application: IHC-P, WBFormat: Liquid. Purified monoclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.Size: 400ul
- YY1 ELISA Kit (Human) (OKDD00599)Catalog #: OKDD00599Application: ELISAKit Range: 0.156-10ng/mLSensitivity: < 0.059 ng/mLSize: 96 Wells