Escherichia coli Protein (ECP) Recombinant, General

Referencia 154467-10ug

embalaje : 10ug

Marca : US Biological

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790


154467 Escherichia coli Protein (ECP) Recombinant, General

Clone Type
Polyclonal
Swiss Prot
P23827
Grade
Highly Purified
Shipping Temp
Blue Ice
Storage Temp
4°C/-70°C

Source:|Recombinant General from E. coli||Accession No:|P23827||Fragment:|Ala21~Arg162 (Accession No: P23827)||Sequence:|MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF -AESVQPLEKI APYPQAEKGM KRQVIQLTPQ EDESTLKVEL LIGQTLEVDC NLHRLGGKLE NKTLEGWGYD YYVFDKVSSP VSTMMACPDG KKEKKFVTAY LGDAGMLRYN SKLPIVVYTP DNVDVKYRVW KAEEKIDNAV VR||Epitope Tag:|N-terminal Tags: His-tag and T7-tag||Molecular Weight:|19.9kD||Applications:|Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.|Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.||Note:|Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

Applications
Source: Recombinant, E. coli|Purity: ≥95%. Endotoxin: ≤1EU/ug (LAL). |Form: Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
Purity
≥95%. Endotoxin: ≤1EU/ug (LAL).