Escherichia coli Protein (ECP) Recombinant, General

Source:|Recombinant General from E. coli||Accession No:|P23827||Fragment:|Ala21~Arg162 (Accession No: P23827)||Sequence:|MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF -AESVQPLEKI APYPQAEKGM KRQVIQLTPQ EDESTLKVEL LIGQTLEVDC NLHRLGGKLE NKTLEGWGYD YYVFDKVSSP VSTMMACPDG KKEKKFVTAY LGDAGMLRYN SKLPIVVYTP DNVDVKYRVW KAEEKIDNAV VR||Epitope Tag:|N-terminal Tags: His-tag and T7-tag||Molecular Weight:|19.9kD||Applications:|Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.|Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.||Note:|Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.