Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommended Dilution	WB, IHC
Reactivities	Human
Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Predicted Protein Size	72 kDa
Gene Name	influenza virus NS1A binding protein
Database Link	NP_006460 Entrez Gene 10625 Human UniProt ID Q9Y6Y0
Background	This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.
Synonyms	FLARA3; HSPC068; KLHL39; ND1; NS-1; NS1-BP; NS1BP
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%; Zebrafish: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors