Clinisciences > LHX1 Antibody - C-terminal region : FITC
LHX1 Antibody - C-terminal region : FITC
Referencia P100851_T100-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Solicitar más información
Por favor, inicie sesión para usar esta función.
Datasheets/Manuals | Printable datasheet for anti-LHX1 (P100851_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LHX1 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85% |
Peptide Sequence | Synthetic peptide located within the following region: PEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-LHX1 (P100851_T100) antibody is Catalog # AAP31210 (Previous Catalog # AAPP01954) |
Reference | Phillips,J.C. et al., (2002) Cytogenet. Genome Res. 97:140D-O |
---|---|
Gene Symbol | LHX1 |
Gene Full Name | LIM homeobox 1 |
Alias Symbols | LIM1, LIM-1 |
NCBI Gene Id | 3975 |
Protein Name | LIM/homeobox protein Lhx1 |
Description of Target | LHX1 is a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. It may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer. |
Uniprot ID | P48742 |
Protein Accession # | NP_005559 |
Nucleotide Accession # | NM_005568 |
Protein Size (# AA) | 406 |
Molecular Weight | 45kDa |
Protein Interactions | ISL1; RLIM; LHX3; OTX2; FOXA2; |
Protein interactions
Name | # of Products |
---|---|
FOXA2 | 20 |
ISL1 | 36 |
LHX3 | 20 |
OTX2 | 20 |
RLIM | 50 |
Biological pathways
Name | # of Products |
---|---|
Cerebellar Purkinje cell differentiation | 3 |
Cerebellar Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation | 3 |
Cervix development | 4 |
Dorsal/ventral pattern formation | 19 |
Ectoderm formation | 9 |
Embryonic retina morphogenesis in camera-type eye | 20 |
Embryonic viscerocranium morphogenesis | 11 |
Endoderm formation | 12 |
Forebrain regionalization | 10 |
Head development | 6 |
Motor axon guidance | 22 |
Negative regulation of transcription, DNA-dependent | 660 |
Neuron migration | 84 |
Oviduct epithelium development | 2 |
Paramesonephric duct development | 10 |
Positive regulation of anterior head development | 2 |
Positive regulation of branching involved in ureteric bud morphogenesis | 57 |
Positive regulation of embryonic development | 14 |
Positive regulation of gastrulation | 19 |
Positive regulation of nephron tubule epithelial cell differentiation | 2 |
Positive regulation of transcription, DNA-dependent | 694 |
Post-embryonic development | 31 |
Primitive streak formation | 21 |
Spinal cord association neuron differentiation | 4 |
Transcription from RNA polymerase II promoter | 338 |
Uterine epithelium development | 2 |
Vagina development | 16 |
Biological process
Name | # of Products |
---|---|
Anatomical structure formation involved in morphogenesis | 22 |
Anatomical structure morphogenesis | 88 |
Anterior/posterior axis specification | 9 |
Anterior/posterior pattern specification | 119 |
Cell differentiation | 490 |
Cell-cell signaling | 235 |
Cellular response to fibroblast growth factor stimulus | 16 |
Cerebellar Purkinje cell differentiation | 8 |
Cerebellar Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation | 3 |
Cerebellum development | 22 |
Cervix development | 2 |
Comma-shaped body morphogenesis | 3 |
Dorsal/ventral pattern formation | 34 |
Ectoderm formation | 3 |
Embryonic pattern specification | 24 |
Embryonic retina morphogenesis in camera-type eye | 6 |
Embryonic viscerocranium morphogenesis | 15 |
Endoderm formation | 16 |
Epithelium development | 5 |
Forebrain regionalization | 3 |
Gastrulation with mouth forming second | 16 |
Head development | 13 |
Horizontal cell localization | 1 |
Kidney development | 92 |
Mesonephric duct development | 4 |
Mesonephros development | 17 |
Metanephric comma-shaped body morphogenesis | 3 |
Metanephric glomerulus development | 1 |
Metanephric renal vesicle morphogenesis | 1 |
Metanephric S-shaped body morphogenesis | 5 |
Metanephric ureteric bud development | 4 |
Metanephros development | 41 |
Motor axon guidance | 26 |
Negative regulation of transcription, DNA-dependent | 520 |
Nephric duct elongation | 1 |
Nephric duct morphogenesis | 2 |
Nervous system development | 384 |
Neuron migration | 89 |
Organ morphogenesis | 132 |
Oviduct development | 2 |
Oviduct epithelium development | 1 |
Paramesonephric duct development | 7 |
Pattern specification process | 111 |
Positive regulation of anterior head development | 2 |
Positive regulation of branching involved in ureteric bud morphogenesis | 26 |
Positive regulation of embryonic development | 6 |
Positive regulation of gastrulation | 7 |
Positive regulation of nephron tubule epithelial cell differentiation | 1 |
Positive regulation of transcription, DNA-dependent | 681 |
Post-embryonic development | 74 |
Primitive streak formation | 12 |
Pronephros development | 8 |
Regulation of gene expression | 75 |
Regulation of transcription, DNA-dependent | 1734 |
Renal vesicle morphogenesis | 1 |
Retina development in camera-type eye | 45 |
Retina layer formation | 14 |
Somite rostral/caudal axis specification | 6 |
Spinal cord association neuron differentiation | 15 |
S-shaped body morphogenesis | 3 |
Telencephalon development | 23 |
Transcription from RNA polymerase II promoter | 302 |
Ureteric bud development | 42 |
Urogenital system development | 20 |
Uterine epithelium development | 1 |
Uterus development | 11 |
Vagina development | 13 |
Ventral spinal cord development | 5 |
Cellular components
Name | # of Products |
---|---|
Intracellular | 1678 |
Nucleus | 4914 |
Protein complex | 216 |
Protein function
Name | # of Products |
---|---|
Metal ion binding | 5514 |
Nucleic acid binding transcription factor activity | 27 |
Sequence-specific DNA binding | 1803 |
Sequence-specific DNA binding transcription factor activity | 2776 |
Transcription corepressor activity | 425 |
Zinc ion binding | 3721 |
- LHX1 Antibody - N-terminal region (ARP32374_P050)Catalog #: ARP32374_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.