OS9 antibody
Referencia orb579264-100ul
embalaje : 100ul
Marca : Biorbyt
Contact local distributor :
Teléfono : +1 850 650 7790
OS9 antibody
Catalog Number: orb579264
| Catalog Number | orb579264 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to OS9 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
| Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human OS9 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 73kDa |
| Target | OS9 |
| UniProt ID | Q13438 |
| Protein Sequence | Synthetic peptide located within the following region: LKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF |
| NCBI | NP_006803 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | OS-9, ERLEC2 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: OS9, Sample Type: Lung Tumor lysates, Antibody Dilution: 1.0 ug/ml.