RBM35A antibody - N-terminal region

Referencia ARP42489_T100

embalaje : 100ul

Marca : Aviva Systems Biology

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

RBM35A Antibody - N-terminal region (ARP42489_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ESRP1 (ARP42489_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RBM35A
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF
Concentration1.0 mg/ml
Blocking PeptideFor anti-ESRP1 (ARP42489_T100) antibody is Catalog # AAP42489 (Previous Catalog # AAPS12903)
Sample Type Confirmation

ESRP1 is supported by BioGPS gene expression data to be expressed in HCT116

Gene SymbolESRP1
Gene Full NameEpithelial splicing regulatory protein 1
Alias SymbolsRBM35A, RMB35A, DFNB109
NCBI Gene Id54845
Protein NameEpithelial splicing regulatory protein 1
Description of TargetThe function remains unknown.
Uniprot IDQ6NXG1-2
Protein Accession #NP_001116297
Nucleotide Accession #NM_001034915
Protein Size (# AA)608
Molecular Weight68kDa
Protein InteractionsATXN1; RNF2; BMI1; UBC;