SMN1 Antibody - N-terminal region
Referencia ARP40209_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-SMN1 (ARP40209_P050) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SMN1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Dog: 100%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 85%; Rat: 92% |
Peptide Sequence | Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SMN1 (ARP40209_P050) antibody is Catalog # AAP40209 (Previous Catalog # AAPP23486) |
Sample Type Confirmation | SMN1 is supported by BioGPS gene expression data to be expressed in MCF7 |
Reference | Hirano,M., (2008) Arch. Neurol. 65 (3), 403-406 |
Publications | Utility of survival motor neuron ELISA for spinal muscular atrophy clinical and preclinical analyses. PLoS One. 6, e24269 (2011). 21904622 |
Description |
Gene Symbol | SMN1 |
---|---|
Gene Full Name | Survival of motor neuron 1, telomeric |
Alias Symbols | SMA, SMN, SMA1, SMA2, SMA3, SMA4, SMA@, SMNT, BCD541, GEMIN1, TDRD16A, T-BCD541 |
NCBI Gene Id | 6606 |
Protein Name | Survival motor neuron protein |
Description of Target | SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7 which is thought to be an exon splice enhancer. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Two transcript variants are produced by this gene. |
Uniprot ID | Q16637 |
Protein Accession # | NP_075012 |
Nucleotide Accession # | NM_022874 |
Protein Size (# AA) | 262 |
Molecular Weight | 28kDa |
Protein Interactions | COPA; RNF2; BMI1; KDM1A; SMN1; RN7SL1; UBC; HDAC11; MIB1; GEMIN4; DICER1; DDX20; PAN2; RBFOX2; HNRNPUL1; IQCB1; UBL4A; SMN2; NOS2; vpr; GEMIN2; SRP68; SRP54; SRP19; SRP9; RNU2-1; RNU1-1; GEMIN5; MDC1; RBM25; COIL; SRSF5; HSPB1; CUL3; DDAH2; MAST2; SMC5; R |
-
What is the species homology for "SMN1 Antibody - N-terminal region (ARP40209_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit".
-
How long will it take to receive "SMN1 Antibody - N-terminal region (ARP40209_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SMN1 Antibody - N-terminal region (ARP40209_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SMN1 Antibody - N-terminal region (ARP40209_P050)"?
This target may also be called "SMA, SMN, SMA1, SMA2, SMA3, SMA4, SMA@, SMNT, BCD541, GEMIN1, TDRD16A, T-BCD541" in publications.
-
What is the shipping cost for "SMN1 Antibody - N-terminal region (ARP40209_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "SMN1 Antibody - N-terminal region (ARP40209_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SMN1 Antibody - N-terminal region (ARP40209_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "28kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SMN1 Antibody - N-terminal region (ARP40209_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SMN1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SMN1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SMN1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SMN1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SMN1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SMN1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.