C3orf67 antibody - N-terminal region

Cat# ARP50865_P050

Size : 100ul

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

C3orf67 Antibody - N-terminal region (ARP50865_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for ARP50865_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C3orf67
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: TDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAESDQFINRG
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP50865 (Previous Catalog # AAPs30302)
Gene SymbolC3orf67
Gene Full NameChromosome 3 open reading frame 67
Alias SymbolsC3orf67
NCBI Gene Id200844
Protein NameUncharacterized protein C3orf67
Description of TargetThe function of the protein remains unknown.
Uniprot IDQ6ZVT6
Protein Accession #NP_940865
Nucleotide Accession #NM_198463
Protein Size (# AA)563
Molecular Weight63kDa