CDK6 (NM_001259) Human Recombinant Protein
Cat# TP308560
Size : 20ug
Contatta il distributore locale :
CDK6 (NM_001259) Human Recombinant Protein
SKU
TP308560
Recombinant protein of human cyclin-dependent kinase 6 (CDK6), 20 µg
- MVPro
Full-length human proteins expressed in HEK293T cells
In Stock*
| Product Data | |
| Species | Human |
|---|---|
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence | Protein Sequence >RC208560 protein sequence Red=Cloning site Green=Tags(s) MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001250 |
| Locus ID | 1021 |
| UniProt ID | Q00534 |
| Cytogenetics | 7q21.2 |
| RefSeq Size | 11628 |
| RefSeq ORF | 978 |
| Synonyms | MCPH12; PLSTIRE |
| Summary | The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer |
Write Your Own Review
| FAQs |
|
| SDS |
Recombinant Protein Resources |
| SKU | Description | Size | ||
|---|---|---|---|---|
| PH308560 | CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001250) | 10 ug | | |
| PH327978 | CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138778) | 10 ug | | |
| LC400506 | CDK6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC428809 | CDK6 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LY400506 | Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 1 | 100 ug | | |
| LY428809 | Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 2 | 100 ug | | |
| TP327978 | Purified recombinant protein of Homo sapiens cyclin-dependent kinase 6 (CDK6), 20 µg | 20 ug | | |
Related Products
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.