Chimeric Rabies Virus Glycoprotein Fragment (RVG - 9R)

Cat# SP2480a

Size : 500ug

Marca : Abcepta

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

Product Information
Sequence NH2-YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR-COOH
Additional Information
Format Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.