EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF) (APC)
Cat# 245789-APC-100ul
Size : 100ul
Marca : US Biological
245789-APC EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF) (APC)
Clone Type
PolyclonalHost
mouseIsotype
IgG2a,kGrade
PurifiedApplications
E WBAccession #
NP_001018051Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeThis gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. [provided by RefSeq||Applications: |Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. ||Note: Applications are based on unconjugated antibody.