EVX1 Antibody - N-terminal region : FITC

Cat# P100830_T100-FITC

Size : 100ul

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

EVX1 Antibody - N-terminal region (P100830_T100)

Datasheets/ManualsPrintable datasheet for anti-EVX1 (P100830_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EVX1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI
Concentration1.0 mg/ml
Blocking PeptideFor anti-EVX1 (P100830_T100) antibody is Catalog # AAP31183 (Previous Catalog # AAPP01926)
ReferenceScherer, S.W., et al., (2003) Science 300 (5620), 767-772
Gene SymbolEVX1
Gene Full NameEven-skipped homeobox 1
Alias SymbolsEVX-1
NCBI Gene Id2128
Protein NameHomeobox even-skipped homolog protein 1
Description of TargetEVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis.
Uniprot IDP49640
Protein Accession #NP_001980
Nucleotide Accession #NM_001989
Protein Size (# AA)407
Molecular Weight42kDa
Protein InteractionsRAD21;