FAH antibody - C-terminal region
Cat# ARP41681_T100
Size : 100ul
Marca : Aviva Systems Biology
Contatta il distributore locale :
Telefono : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for anti-FAH (ARP41681_T100) antibody |
|---|
| Publications | Functional and Biochemical Characterization of Hepatitis C Virus (HCV) Particles Produced in a Humanized Liver Mouse Model. J. Biol. Chem. 290, 23173-87 (2015). 2622463324465277 |
|---|---|
| Tested Species Reactivity | Human, Mouse |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Additional Information | IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAH |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-FAH (ARP41681_T100) antibody is Catalog # AAP41681 (Previous Catalog # AAPP24324) |
| Other Applications Image 1 Data | Sample Type: Human Liver and Mouse FAH KO liver Primary Dilution: 1:400 |
| Reference | Bliksrud,Y.T., (2005) J. Mol. Med. 83 (5), 406-410 |
|---|---|
| Gene Symbol | FAH |
| Gene Full Name | Fumarylacetoacetate hydrolase (fumarylacetoacetase) |
| NCBI Gene Id | 2184 |
| Protein Name | Fumarylacetoacetase |
| Description of Target | FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). |
| Uniprot ID | P16930 |
| Protein Accession # | NP_000128 |
| Nucleotide Accession # | NM_000137 |
| Protein Size (# AA) | 419 |
| Molecular Weight | 46kDa |
| Protein Interactions | KRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR; |
-
What is the species homology for "FAH Antibody - C-terminal region (ARP41681_T100)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "FAH Antibody - C-terminal region (ARP41681_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "FAH Antibody - C-terminal region (ARP41681_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FAH Antibody - C-terminal region (ARP41681_T100)"?
This target may also be called "" in publications.
-
What is the shipping cost for "FAH Antibody - C-terminal region (ARP41681_T100)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "FAH Antibody - C-terminal region (ARP41681_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FAH Antibody - C-terminal region (ARP41681_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "46kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FAH Antibody - C-terminal region (ARP41681_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FAH"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FAH"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FAH"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FAH"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FAH"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FAH"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.