- Specifications
Product Description
Human FSHB partial ORF ( NP_000501.1, 19 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.95
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — FSHB
Entrez GeneID
2488GeneBank Accession#
NM_000510Protein Accession#
NP_000501.1Gene Name
FSHB
Gene Alias
-
Gene Description
follicle stimulating hormone, beta polypeptide
Gene Ontology
HyperlinkGene Summary
The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq
Other Designations
follicle-stimulating hormone beta subunit|follitropin, beta chain
- Pathways
- Diseases
FSHB (Human) Recombinant Protein (Q01)
Cat# H00002488-Q01-25ug
Size : 25ug
Marca : Abnova
Images