OPCA02979-100UG | Fusion glycoprotein F0 Recombinant Protein Clinisciences

Datasheets/Manuals	Printable datasheet for F Recombinant Protein (Human respiratory syncytial virus B) (OPCA02979)

Product Info
Predicted Species Reactivity	Human Orthopneumovirus\|Human respiratory syncytial virus B\|Human Respiratory Syncytial Virus B
Product Format	Liquid or Lyophilized powder
Reconstitution and Storage	-20°C or -80°C
Peptide Sequence	FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETVIEFQQKNSRLLEINREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKVQSNRVFCDTMNSLTLPSEVSLCNTDIFNSKYDCKIMTSKTDISSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDPLVFPSDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTTNIMITTIIIVIIVVLLSLIAIGLLLYCKAKNTPVTLSKDQLSGINNIAFSK
Source	Yeast

Gene Symbol	F
Gene Full Name	fusion glycoprotein
Alias Symbols	fusion glycoprotein, HRSVgp08.
NCBI Gene Id	1489825
Protein Name	Fusion glycoprotein F0
Description of Target	During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participate in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis.
Uniprot ID	O36634
Protein Size (# AA)	Partial
Molecular Weight	50.1 kda

Fusion glycoprotein F0 Recombinant Protein