IL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (APC)
Cat# 128389-APC-100ul
Size : 100ul
Marca : US Biological
128389-APC IL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (APC)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
NP_002179Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeInterleukin-13 (IL-13) is an immunoregulatory protein produced by activated T lymphocytes. The biological activities of IL-13 include the stimulation of B cell proliferation and immunoglobulins production.||Applications:|Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.||Recommended Dilutions:|Immunohistochemistry: Formalin fixed, paraffin embedded tissues |Optimal dilutions to be determined by the researcher.||Amino Acid Sequence:|MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.