Ki-67 Protein (Ki67P) Recombinant, Human
Cat# 155544-10ug
Size : 10ug
Marca : US Biological
155544 Rabbit Anti-Ki-67 Protein (Ki67P) Recombinant, Human
Clone Type
PolyclonalSwiss Prot
P46013Grade
Highly PurifiedShipping Temp
Blue IceStorage Temp
4°C/-70°CSource:|Recombinant Human from E. coli||Purity:|≥95%||Endotoxin:|1.0EU per 1ug (determined by the LAL method)||Accession No:|P46013||Fragment:|Gly3088~Lys3235 (Accession No: P46013)||Sequence:|MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GIS LRSRRQNKTE AEQQITEVFV LAERIEINRN EKKPMKTSPE MDIQNPDDGA RKPIPRDKVT ENKRCLRSAR QNESSQPKVA EESGGQKSAK VLMQNQKGKG EAGNSDSMCL RSRKTKSQPA ASTLESKSVQ RVTRSVKRCA ENPKK||Epitope Tag:|N-terminal Tags: His-tag and S-tag||Molecular Weight:|22.3kD||Applications:|Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.|Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note:|Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.