MCP1 (CCL2) (NM_002982) Human Recombinant Protein

Cat# TP302180

Size : 20ug

Contatta il distributore locale :


Telefono :

MCP1 (CCL2) (NM_002982) Human Recombinant Protein

SKU
TP302180
Recombinant protein of human chemokine (C-C motif) ligand 2 (CCL2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

In Stock*
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202180 protein sequence
Red=Cloning site Green=Tags(s)

MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV
AKEICADPKQKWVQDSMDHLDKQTQTPKT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002973
Locus ID 6347
UniProt ID P13500
Cytogenetics 17q12
RefSeq Size 760
RefSeq ORF 297
Synonyms GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Summary This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection. [provided by RefSeq, Aug 2020]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway
Write Your Own Review
You're reviewing:MCP1 (CCL2) (NM_002982) Human Recombinant Protein
Your Rating
SKU Description Size
PH302180 CCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002973) 10 ug
LC401046 CCL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY401046 Transient overexpression lysate of chemokine (C-C motif) ligand 2 (CCL2) 100 ug
TP723718 Purified recombinant protein of Human chemokine (C-C motif) ligand 2 (CCL2 / MCP-1) 10 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced
HY-P7191-50ug
 50ug 
HY-P7258-10ug
 10ug