MFN1 Antibody - middle region
Cat# ARP57702_P050-25UL
Size : 25ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-MFN1 (ARP57702_P050) antibody |
---|
Publications | Bonala, S. et al. Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity. Mol. Endocrinol. 27, 1518-35 (2013). 239279301$s> Papanicolaou, K. N. et al. Mitofusin-2 maintains mitochondrial structure and contributes to stress-induced permeability transition in cardiac myocytes. Mol. Cell. Biol. 31, 1309-28 (2011). 212453731$s> | ||||||
---|---|---|---|---|---|---|---|
Tested Species Reactivity | Human, Mouse | ||||||
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit | ||||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
Clonality | Polyclonal | ||||||
Host | Rabbit | ||||||
Application | WB | ||||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MFN1 | ||||||
Purification | Affinity Purified | ||||||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100% | ||||||
Peptide Sequence | Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ | ||||||
Concentration | 0.5 mg/ml | ||||||
Blocking Peptide | For anti-MFN1 (ARP57702_P050) antibody is Catalog # AAP57702 (Previous Catalog # AAPP42948) | ||||||
Enhanced Validation |
|
Gene Symbol | MFN1 |
---|---|
Gene Full Name | Mitofusin 1 |
Alias Symbols | hfzo1, hfzo2 |
NCBI Gene Id | 55669 |
Protein Name | Mitofusin-1 |
Description of Target | The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting. |
Uniprot ID | Q8R4Z9 |
Protein Accession # | NP_284941 |
Nucleotide Accession # | NM_033540 |
Protein Size (# AA) | 741 |
Molecular Weight | 84 kDa |
Protein Interactions | PARK2; MARCH5; UBC; TER94; MAVS; CCNB1; ILF2; BAK1; |