May play a role in eye development.||Applications:|Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Immunofluorescence: 10ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.