PDK2 antibody - middle region

Cat# ARP31778_P050

Size : 100ul

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-PDK2 (ARP31778_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded heart tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PDK2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDK2 (ARP31778_P050) antibody is Catalog # AAP31778 (Previous Catalog # AAPP02569)
Sample Type Confirmation

PDK2 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceHiromasa,Y., (2008) Biochemistry 47 (8), 2312-2324
Gene SymbolPDK2
Gene Full NamePyruvate dehydrogenase kinase, isozyme 2
Alias SymbolsPDHK2, PDKII
NCBI Gene Id5164
Protein Name[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial
Description of TargetPDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
Uniprot IDQ15119
Protein Accession #NP_002602
Nucleotide Accession #NM_002611
Protein Size (# AA)407
Molecular Weight44kDa
Protein InteractionsVSIG4; DLAT; ISOC2; HIC2; SGK1; PDK2; PDK1; PDHA1; PDHX; AKT1; HTT;
  1. What is the species homology for "PDK2 Antibody - middle region (ARP31778_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PDK2 Antibody - middle region (ARP31778_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PDK2 Antibody - middle region (ARP31778_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PDK2 Antibody - middle region (ARP31778_P050)"?

    This target may also be called "PDHK2, PDKII" in publications.

  5. What is the shipping cost for "PDK2 Antibody - middle region (ARP31778_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "PDK2 Antibody - middle region (ARP31778_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PDK2 Antibody - middle region (ARP31778_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PDK2 Antibody - middle region (ARP31778_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced
OAAF05910
 100ug 
250673
 0.1mg