PDK2 Antibody - middle region
Cat# ARP31778_P050-25UL
Size : 25ul
Marca : Aviva Systems Biology
Contatta il distributore locale :
Telefono : +1 850 650 7790
PDK2 Antibody - middle region (ARP31778_P050)
| Datasheets/Manuals | Printable datasheet for anti-PDK2 (ARP31778_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Additional Information | IHC Information: Paraffin embedded heart tissue, tested with an antibody dilution of 5 ug/ml. |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PDK2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 77%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PDK2 (ARP31778_P050) antibody is Catalog # AAP31778 (Previous Catalog # AAPP02569) |
| Sample Type Confirmation | PDK2 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Reference | Hiromasa,Y., (2008) Biochemistry 47 (8), 2312-2324 |
|---|---|
| Gene Symbol | PDK2 |
| Gene Full Name | Pyruvate dehydrogenase kinase, isozyme 2 |
| Alias Symbols | PDHK2, PDKII |
| NCBI Gene Id | 5164 |
| Protein Name | [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial |
| Description of Target | PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism. |
| Uniprot ID | Q15119 |
| Protein Accession # | NP_002602 |
| Nucleotide Accession # | NM_002611 |
| Protein Size (# AA) | 407 |
| Molecular Weight | 44kDa |
| Protein Interactions | VSIG4; DLAT; ISOC2; HIC2; SGK1; PDK2; PDK1; PDHA1; PDHX; AKT1; HTT; |
