Pectate Lyase 1, Recombinant, Chamaecyparis obtusa, aa22-354, His-SUMO-Tag

Cat# 374660-100ug

Size : 100ug

Marca : US Biological

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790


374660 Pectate Lyase 1, Recombinant, Chamaecyparis obtusa, aa22-354, His-SUMO-Tag

Clone Type
Polyclonal
Swiss Prot
Q96385
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Has pectate lyase activity.||Source:|Recombinant protein corresponding to aa22-354 from chamaecyparis obtusa, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.||Molecular Weight: |~52.0kD||Amino Acid Sequence:|DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGS||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Purity
≥90% (SDS-PAGE)
References
1. Purification, characterization and molecular cloning of Cha o 1, a major allergen of Chamaecyparis obtusa (Japanese cypress) pollen. Suzuki M., Komiyama N., Itoh M., Itoh H., Sone T., Kuno K., Takagi I., Ohta N.Mol. Immunol. 33:451-460(1996).