Pectate Lyase 1, Recombinant, Chamaecyparis obtusa, aa22-354, His-SUMO-Tag
Cat# 374660-100ug
Size : 100ug
Marca : US Biological
374660 Pectate Lyase 1, Recombinant, Chamaecyparis obtusa, aa22-354, His-SUMO-Tag
Clone Type
PolyclonalSwiss Prot
Q96385Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CHas pectate lyase activity.||Source:|Recombinant protein corresponding to aa22-354 from chamaecyparis obtusa, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.||Molecular Weight: |~52.0kD||Amino Acid Sequence:|DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGS||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.