TA337984 | Rabbit Polyclonal Anti-YRDC Antibody Clinisciences

YRDC Rabbit Polyclonal Antibody

SKU

TA337984

Rabbit Polyclonal Anti-YRDC Antibody

Specifications
Product Data
Application	WB
Recommended Dilution	WB
Reactivity	Human
Antibody Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-YRDC antibody is: synthetic peptide directed towards the middle region of Human YRDC. Synthetic peptide located within the following region: VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ
Buffer	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Shipping	Blue Ice
Predicted Protein Size	24 kDa
Gene Name	yrdC N6-threonylcarbamoyltransferase domain containing
Database Link	NP_078916 Q86U90
Background	YRDC may regulate the activity of some transporters.
Synonyms	DRIP3; IRIP; SUA5
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 83%; Zebrafish: 79%
Reference Data

Product Manuals
Goat anti-Mouse IgG [H&L] Western Blotting Luminol Kit
FAQs
Antibody and Western Standard
SDS
SDS for TA337984

Antibody Resources
Product Overview Video: TrueMAB Video Tutorial: Video Tutorial: Antibody specificity and Knockout(KO) lysates Western Blot Protocol IHC Protocol IF Protocol FACS Protocol Immunoprecipitation (IP) Protocol IP protocol with magnetic beads