Recombinant Human Trifunctional Purine  Biosynthetic Protein Adenosine-3, aa111-318, His-Tag

Source:|Recombinant protein corresponding to aa111-318 from human Trifunctional purine biosynthetic protein adenosine-3, fused to 6X His-Tag at N-terminal, expressed in E.coli.||Molecular Weight: |~26.5kD||Amino Acid Sequence:|KEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLD||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.