RHAG antibody - middle region

Cat# ARP41705_T100

Size : 100ul

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-RHAG (ARP41705_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RHAG
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
Concentration1.0 mg/ml
Blocking PeptideFor anti-RHAG (ARP41705_T100) antibody is Catalog # AAP41705 (Previous Catalog # AAPP24348)
ReferenceNorberg,A., (2006) Neurosci. Lett. 396 (2), 137-142
Gene SymbolRHAG
Gene Full NameRh-associated glycoprotein
Alias SymbolsOHS, RH2, OHST, RHNR, Rh50, CD241, RH50A, Rh50GP, SLC42A1
NCBI Gene Id6005
Protein NameAmmonium transporter Rh type A
Description of TargetThe Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.The Rh blood group antigens (MIM 111700) are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47 (MIM 601028), LW (MIM 111250), glycophorin B (MIM 111740), and play a critical role in the Rh50 glycoprotein.[supplied by OMIM].
Uniprot IDQ02094
Protein Accession #NP_000315
Nucleotide Accession #NM_000324
Protein Size (# AA)409
Molecular Weight45kDa
Protein InteractionsCD47; ANK1; GYPB; ICAM4; SLC4A1;
  1. What is the species homology for "RHAG Antibody - middle region (ARP41705_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "RHAG Antibody - middle region (ARP41705_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RHAG Antibody - middle region (ARP41705_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RHAG Antibody - middle region (ARP41705_T100)"?

    This target may also be called "OHS, RH2, OHST, RHNR, Rh50, CD241, RH50A, Rh50GP, SLC42A1" in publications.

  5. What is the shipping cost for "RHAG Antibody - middle region (ARP41705_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "RHAG Antibody - middle region (ARP41705_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RHAG Antibody - middle region (ARP41705_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RHAG Antibody - middle region (ARP41705_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RHAG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RHAG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RHAG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RHAG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RHAG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RHAG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced
ARP63085_P050
 100ul 
ARP63086_P050
 100ul