Small Heat Shock Protein ibpA, Recombinant, Yersinia pestis bv. Antiqua, aa1-137, His-Tag

Cat# 586359-20ug

Size : 20ug

Marca : US Biological

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790


586359 Small Heat Shock Protein ibpA, Recombinant, Yersinia pestis bv. Antiqua, aa1-137, His-Tag

Clone Type
Polyclonal
Swiss Prot
Q1CD74
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Associates with aggregated proteins, together with IbpB, to stabilize and protect them from irreversible denaturation and extensive proteolysis during heat shock and oxidative stress. Aggregated proteins bound to the IbpAB complex are more efficiently refolded and reactivated by the ATP-dependent chaperone systems ClpB and DnaK/DnaJ/GrpE. Its activity is ATP-independent.||Source:|Recombinant protein corresponding to aa1-137 from Yersinia pestis bv. Antiqua Small heat shock protein ibpA, fused to 6X His-Tag at N-terminal, expressed in E.coli.||Molecular Weight: |~21.6kD||Amino Acid Sequence:|MRNSDLAPLYRSAIGFDRLFNLLESGQNQSNGGYPPYNVELVDENNYRIAIAVAGFAEQELEITTQDNLLIVRGSHANEPAQRTYLYQGIAERNFERKFQLAEHIKIKGANLVNGLLYIDLERLVPESLKPRRIEIK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol
Purity
≥85% (SDS-PAGE)