STIP1 Antibody - N-terminal region : HRP

Cat# ARP46164_T100-HRP

Size : 100ul

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-STIP1 (ARP46164_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STIP1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 91%
Peptide SequenceSynthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
Concentration1.0 mg/ml
Blocking PeptideFor anti-STIP1 (ARP46164_T100) antibody is Catalog # AAP46164 (Previous Catalog # AAPP27003)
Sample Type Confirmation

STIP1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceBruneel,A., (2005) Proteomics 5 (15), 3876-3884
Gene SymbolSTIP1
Gene Full NameStress-induced-phosphoprotein 1
Alias SymbolsHOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521
NCBI Gene Id10963
Protein NameStress-induced-phosphoprotein 1
Description of TargetSTIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
Uniprot IDP31948
Protein Accession #NP_006810
Nucleotide Accession #NM_006819
Protein Size (# AA)543
Molecular Weight63kDa
Protein InteractionsHSP90AA1; UBC; MLF2; CCDC117; CDC37L1; HSP90AB1; DNAJB6; BAG2; MDM2; rev; COPS4; CDK9; CDK5; CDK3; PGR; HSPA8; HSPA4; SLC12A3; PWP2; PPP5C; NOS2; LMO2; ITGA4; FN1; ATF2; MAP3K8; METTL21B; KCNQ4; VCAM1; KCNH2; Htt; AHCYL1; SSSCA1; PSMC6; PSMC3; NASP; STMN1
  1. What is the species homology for "STIP1 Antibody - N-terminal region (ARP46164_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast".

  2. How long will it take to receive "STIP1 Antibody - N-terminal region (ARP46164_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STIP1 Antibody - N-terminal region (ARP46164_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STIP1 Antibody - N-terminal region (ARP46164_T100)"?

    This target may also be called "HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521" in publications.

  5. What is the shipping cost for "STIP1 Antibody - N-terminal region (ARP46164_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "STIP1 Antibody - N-terminal region (ARP46164_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STIP1 Antibody - N-terminal region (ARP46164_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STIP1 Antibody - N-terminal region (ARP46164_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "STIP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STIP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STIP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STIP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STIP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STIP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.