Ubiquitin-like Protein SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (SMT3)

Not known; suppressor of MIF2 mutations.||Source:|Recombinant protein corresponding to aa2-98 from Saccharomyces cerevisiae SMT3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.||Molecular Weight:|~27.12kD||Amino Acid Sequence:|SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.