YRDC Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-YRDC antibody is: synthetic peptide directed towards the middle region of Human YRDC. Synthetic peptide located within the following region: VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 24 kDa |
Gene Name | yrdC N6-threonylcarbamoyltransferase domain containing |
Database Link | |
Background | YRDC may regulate the activity of some transporters. |
Synonyms | DRIP3; IRIP; SUA5 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 83%; Zebrafish: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
|
SDS |
Resources
Antibody Resources |
|