Specifications

Product Data
Applications	WB
Recommended Dilution	WB
Reactivities	Human
Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-YRDC antibody is: synthetic peptide directed towards the middle region of Human YRDC. Synthetic peptide located within the following region: VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Predicted Protein Size	24 kDa
Gene Name	yrdC N6-threonylcarbamoyltransferase domain containing
Database Link	NP_078916 Entrez Gene 79693 Human UniProt ID Q86U90
Background	YRDC may regulate the activity of some transporters.
Synonyms	DRIP3; IRIP; SUA5
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 83%; Zebrafish: 79%
Reference Data