CD34 antibody - C-terminal region

Cat# ARP60993_P050

Size : 100ul

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

CD34 Antibody - C-terminal region (ARP60993_P050)

Datasheets/ManualsPrintable datasheet for anti-CD34 (ARP60993_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Goat, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CD34
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Goat: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 77%
Peptide SequenceSynthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD34 (ARP60993_P050) antibody is Catalog # AAP60993 (Previous Catalog # AAPP47131)
Gene SymbolCD34
Gene Full NameCD34 molecule
Alias Symbols-
NCBI Gene Id947
Protein NameCD34 antigen EMBL BAE46748.1
Description of TargetCD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells.
Uniprot IDQ3C1E7
Protein Accession #NP_001764
Nucleotide Accession #NM_001773
Protein Size (# AA)328
Molecular Weight35kDa
Protein InteractionsCHST4; CRKL; PRKCD; ATF5; CREM;