CD34 antibody - C-terminal region
Cat# ARP60993_P050
Size : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-CD34 (ARP60993_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Dog, Goat, Guinea Pig, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD34 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Dog: 86%; Goat: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 77% |
Peptide Sequence | Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CD34 (ARP60993_P050) antibody is Catalog # AAP60993 (Previous Catalog # AAPP47131) |
Gene Symbol | CD34 |
---|---|
Gene Full Name | CD34 molecule |
Alias Symbols | - |
NCBI Gene Id | 947 |
Protein Name | CD34 antigen EMBL BAE46748.1 |
Description of Target | CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells. |
Uniprot ID | Q3C1E7 |
Protein Accession # | NP_001764 |
Nucleotide Accession # | NM_001773 |
Protein Size (# AA) | 328 |
Molecular Weight | 35kDa |
Protein Interactions | CHST4; CRKL; PRKCD; ATF5; CREM; |