CYP11B1 Antibody - C-terminal region : Biotin
Cat# ARP60140_P050-Biotin
Size : 100ul
Marca : Aviva Systems Biology
Contatta il distributore locale :
Telefono : +1 850 650 7790
CYP11B1 Antibody - C-terminal region (ARP60140_P050)
| Datasheets/Manuals | Printable datasheet for anti-CYP11B1 (ARP60140_P050) antibody |
|---|
| Tested Species Reactivity | Human, Monkey | ||
|---|---|---|---|
| Predicted Species Reactivity | Human, Pig, Sheep, Monkey | ||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
| Clonality | Polyclonal | ||
| Host | Rabbit | ||
| Application | IHC, WB | ||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1 | ||
| Purification | Affinity Purified | ||
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Pig: 79%; Sheep: 79% | ||
| Peptide Sequence | Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL | ||
| Concentration | 0.5 mg/ml | ||
| Blocking Peptide | For anti-CYP11B1 (ARP60140_P050) antibody is Catalog # AAP60140 (Previous Catalog # AAPP46274) | ||
| Enhanced Validation |
|
| Gene Symbol | CYP11B1 |
|---|---|
| Gene Full Name | Cytochrome P450, family 11, subfamily B, polypeptide 1 |
| Alias Symbols | FHI, CPN1, CYP11B, P450C11 |
| NCBI Gene Id | 1584 |
| Protein Name | Cytochrome P450 11B1, mitochondrial |
| Description of Target | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. |
| Uniprot ID | P15538 |
| Protein Accession # | NP_000488 |
| Nucleotide Accession # | NM_000497 |
| Protein Size (# AA) | 503 |
| Molecular Weight | 58 kDa |
| Protein Interactions | CYP11B2; |
