PAX2 Antibody - middle region : HRP

Cat# P100859_T100-HRP

Size : 100ul

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

PAX2 Antibody - middle region (P100859_T100)

Datasheets/ManualsPrintable datasheet for anti-PAX2 (P100859_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PAX2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS
Concentration1.0 mg/ml
Blocking PeptideFor anti-PAX2 (P100859_T100) antibody is Catalog # AAP31220 (Previous Catalog # AAPP01965)
ReferenceMuratovska, A., et al., (2003) Oncogene 22 (39), 7989-7997.
Gene SymbolPAX2
Gene Full NamePaired box 2
Alias SymbolsFSGS7, PAPRS
NCBI Gene Id5076
Protein NamePaired box protein Pax-2
Description of TargetPAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.
Uniprot IDQ02962
Protein Accession #NP_003979
Nucleotide Accession #NM_003988
Protein Size (# AA)417
Molecular Weight45kDa
Protein InteractionsBBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2;