Rala Antibody - N-terminal region

Cat# ARP56642_P050-25UL

Size : 25ul

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

Rala Antibody - N-terminal region (ARP56642_P050)

Datasheets/ManualsPrintable datasheet for anti-Rala (ARP56642_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rala
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY
Concentration0.5 mg/ml
Blocking PeptideFor anti-Rala (ARP56642_P050) antibody is Catalog # AAP56642
Gene SymbolRala
Gene Full Namev-ral simian leukemia viral oncogene homolog A (ras related)
Alias Symbols-
NCBI Gene Id81757
Protein NameRas-related protein Ral-A
Description of TargetRala is a putative GTP binding protein.
Uniprot IDP63322
Protein Accession #NP_112355
Nucleotide Accession #NM_031093
Protein Size (# AA)206
Molecular Weight22kDa
Protein InteractionsUbc; Ralbp1; Ybx3; CSDA; Exoc8;