UBR3 Antibody : HRP
Cat# ARP43449_P050-HRP
Size : 100ul
Marca : Aviva Systems Biology
Contatta il distributore locale :
Telefono : +1 850 650 7790
UBR3 Antibody - C-terminal region (ARP43449_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-UBR3 (ARP43449_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UBR3 |
| Purification | Affinity purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-UBR3 (ARP43449_P050) antibody is Catalog # AAP43449 |
| Gene Symbol | UBR3 |
|---|---|
| Gene Full Name | ubiquitin protein ligase E3 component n-recognin 3 (putative) |
| Alias Symbols | ZNF650 |
| NCBI Gene Id | 130507 |
| Protein Name | E3 ubiquitin-protein ligase UBR3 |
| Description of Target | E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. |
| Uniprot ID | Q6ZT12-3 |
| Protein Size (# AA) | 43 |
| Molecular Weight | 394 |
| Protein Interactions | DZIP3; UBC; UBE2Z; UBE2B; UBE2A; |