AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (HRP)

Cat# 123100-HRP-100ul

Size : 100ul

Marca : US Biological

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790


123100-HRP AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (HRP)

Clone Type
Polyclonal
Host
mouse
Source
human
Isotype
IgG1,k
Grade
Affinity Purified
Applications
E WB
Crossreactivity
Hu
Accession #
NM_016633, NP_057717.1
Shipping Temp
Blue Ice
Storage Temp
-20°C

AHSP (Alpha-hemoglobin stabilizing protein), also known as ERAF (Erythroid associated factor), is an erythroid-specific protein that acts as a chaperone to prevent the aggregation of aplha-hemoglobin during normal erythroid cell development. It specifically protects free alpha-hemoglobin from precipitation in live cells and in solution. This protein is downregulated in transmissible spongiform encephalopathies (TSEs). It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. Recombinant AHSP protein, expressed in E. coli and purified by using conventional chromatography techniques.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilutions:|Optimal dilutions to be determined by the researcher.||Amino Acid Sequence:|MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG1,k|Clone No: 2E4|Host: mouse|Source: human|Concentration: As Reported |Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Full length recombinant corresponding to aa1-102 from human AHSP with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human AHSP.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Full length recombinant corresponding to aa1-102 from human AHSP with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human AHSP.