ATRX (Transcriptional Regulator ATRX, ATP-dependent Helicase ATRX, X-linked Helicase II, X-linked Nuclear Protein, XNP, Znf-HX, ATRX, RAD54L, XH2) (FITC)

Cat# 123754-FITC-100ul

Size : 100ul

Marca : US Biological

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790


123754-FITC ATRX (Transcriptional Regulator ATRX, ATP-dependent Helicase ATRX, X-linked Helicase II, X-linked Nuclear Protein, XNP, Znf-HX, ATRX, RAD54L, XH2) (FITC)

Clone Type
Polyclonal
Host
mouse
Source
human
Isotype
IgG1,k
Grade
Affinity Purified
Applications
E WB
Crossreactivity
Hu
Accession #
NM_000489, NP_000480
Shipping Temp
Blue Ice
Storage Temp
-20°C

The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILM||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG1,k|Clone No: 3C9|Host: mouse|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa2311-2410 from human ATRX (NP_000480) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human ATRX.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa2311-2410 from human ATRX (NP_000480) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ATRX.