HSD3B2 Antibody - N-terminal region : HRP
Cat# ARP44239_P050-HRP
Size : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-HSD3B2 (ARP44239_P050) antibody |
---|
Tested Species Reactivity | Human, Monkey |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Sheep, Monkey |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 93%; Goat: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 86%; Sheep: 85% |
Peptide Sequence | Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HSD3B2 (ARP44239_P050) antibody is Catalog # AAP44239 (Previous Catalog # AAPP25619) |
Reference | Shigematsu,K., (2008) Eur. J. Endocrinol. 158 (6), 867-878 |
---|---|
Gene Symbol | HSD3B2 |
Gene Full Name | Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 |
Alias Symbols | HSDB, HSD3B, SDR11E2 |
NCBI Gene Id | 3284 |
Protein Name | 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 |
Description of Target | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. |
Uniprot ID | P26439 |
Protein Accession # | NP_000189 |
Nucleotide Accession # | NM_000198 |
Protein Size (# AA) | 372 |
Molecular Weight | 42kDa |
Protein Interactions | ATP4A; |